PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN08548.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 291aa    MW: 32348 Da    PI: 7.2698
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN08548.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof110.76.8e-3542101261
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                 +++ lkcprCds ntkfCyynny+ sqPr++C+aC+r+WtkGG+lrnvPvGggr++++ +
  KHN08548.1  42 PSEPLKCPRCDSINTKFCYYNNYNKSQPRHYCRACKRHWTKGGTLRNVPVGGGRKNKRVK 101
                 67899***********************************************97766544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-194390IPR003851Zinc finger, Dof-type
PfamPF027014.1E-314598IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.9946100IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104884IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MGLSSKQVSN RGLDWNQTLL EAQNLELPKP PPMRKQQQQT QPSEPLKCPR CDSINTKFCY  60
YNNYNKSQPR HYCRACKRHW TKGGTLRNVP VGGGRKNKRV KKSTTPNTAT ATNSISTTTT  120
TSNTNMDGEL NTPITIPLFA VDDHKTTPSS LYQSLCLPQQ NLMMSTKDSE EGKDFGIGNG  180
IFLSSTVPFP QSQSLLFPFT TSNSFDTNQC AISSSLRSSS VYNYGEEFKI TEEPTINSIM  240
PNASGGTNTQ PWEIAATSSG LEMSNYWTWE DIDSLVSTDL NVPWDDSDIK P
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF2217510.0EF221751.1 Glycine max Dof6 transcription factor (Dof6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001236615.10.0Dof6 transcription factor
TrEMBLA0A0B2PLM70.0A0A0B2PLM7_GLYSO; Dof zinc finger protein DOF1.4
STRINGGLYMA13G31560.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51073356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.13e-24DOF zinc finger protein 1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]